Platz 6 in Tagesstatistik bei Genome

Nachricht

Dr.Evil · #1 Ungelesener Beitrag von **Dr.Evil** » 17.10.2003 05:52

1 6) P2P_Projet100k 11715.67 11715.67 10312.27 3607638.83 -
2 5) Alliance_francophone 7003.29 7003.29 6576.42 3722507.17 -
3 3) The_Genome_Collective 3491.92 3491.92 2837.33 6393204.96 -
4 13) Czech_Republic 2902.84 2902.84 3032.93 1681914.53 -
5 7) Dutch_Power_Cows 2349.34 2349.34 2329.66 2914604.98 -
6 93) Germany 2193.95 2193.95 605.74 111549.97

fuer den 16.October 21 Uhr Stanford-Time

Und das bevor des offiziellen Taskforce-Einsatzes ! WOW !!!!

#2 Ungelesener Beitrag von **Michael H.W. Weber** » 17.10.2003 09:34

Astrein!

Michael.

^r00t^ · #3 Ungelesener Beitrag von **^r00t^** » 17.10.2003 10:29

Die holen uns nicht!

Dr.Evil · #4 Ungelesener Beitrag von **Dr.Evil** » 18.10.2003 05:31

Der 17.Oct. brachte uns Platz 7 in der Tagestatistik.Unsere Herausforderer,das Moscow Team, landete auf Rang 11,mit weniger als halbsoviel Wu's.

Pos
Rank & Team Name Units submitted on 1 day
units Avg units
per day Total units Days to
overtake
Oct17
1 6) P2P_Projet100k 11326.42 11326.42 10214.84 3618965.25 -
2 5) Alliance_francophone 6392.57 6392.57 6504.10 3728899.74 -
3 3) The_Genome_Collective 3036.50 3036.50 2834.95 6396241.46 -
4 13) Czech_Republic 2796.95 2796.95 2982.57 1684711.48 -
5 7) Dutch_Power_Cows 2164.08 2164.08 2264.13 2916769.06 -
6 18) The_Lab 2064.52 2064.52 1899.01 914393.62 -
7 90) Germany 2014.18 2014.18 861.80 113564.15 -
8 10) DSL_Reports_Team_Helix 1517.89 1517.89 1458.86 2672032.58 -
9 24) Les_Decodeurs_fous 1157.64 1157.64 1204.18 611367.19 -
10 64) TyOI 989.35 989.35 1925.31 166341.14 -
11 95) Moscow 941.00 941.00 817.02 109870.41

#5 Ungelesener Beitrag von **Michael H.W. Weber** » 18.10.2003 06:05

Eben sehe ich, daß wir bereits Platz 90 im weltweiten Gesamtteamranking übernommen haben, während Team Moscow noch immer fein auf Platz 95 hockt.

Michael.

#6 Ungelesener Beitrag von **frank** » 18.10.2003 11:14

Michael H.W. Weber hat geschrieben:Eben sehe ich, daß wir bereits Platz 90 im weltweiten Gesamtteamranking übernommen haben, während Team Moscow noch immer fein auf Platz 95 hockt.

Michael.

Sie sind ja inzwischen auch echt ruhig geworden. Nix mehr mit dicke Lippe im Forum *g*

Macht weiter so!

frank

#7 Ungelesener Beitrag von **Michael H.W. Weber** » 18.10.2003 17:14

Platz 89 wurde eben erreicht - kommt man ja kaum noch mit, so schnell steigen wir auf.

Michael.

#8 Ungelesener Beitrag von **Dennis Kautz** » 18.10.2003 17:57

Übrigens sind wir heute in der Tagesstatistik bisher auf Platz 5.... VOR den DPC

#9 Ungelesener Beitrag von **Michael H.W. Weber** » 19.10.2003 07:23

Wir erreichten eben Platz 86. Die Russen verweilen noch immer auf Rang 95.

Im Augenblick kicken wir über 10.000 Punkte pro Woche raus. Tendenz steigend. Wir müssen daher unsere Eingangsprognosen korrigieren: Statt innerhalb eines 14-tägigen TF-Einsatzes "nur" Platz 83 zu erreichen, werden wir nun mindestens Platz 75 übernehmen. Damit steigen wir mindestens 20 Ränge auf. Das ist der absolute Hammer und übertrifft bereits jetzt all meine Erwartungen.

Michael.

Thorm[bd] · #10 Ungelesener Beitrag von **Thorm[bd]** » 19.10.2003 10:43

oh man, der Server hat bei mir heute nacht die Verbindung abgeworfen und der Client konnte die WU nicht hochladen. Nun hab ich den Client nochmal gestartet und er fängt wieder ganz von vorne an!
Ist die WU jetzt verloren?

Gruß
Thorm

#11 Ungelesener Beitrag von **Michael H.W. Weber** » 19.10.2003 10:55

Ich denke, die WU wurde entweder gesendet oder befindet sich noch in der Warteschleife. Bitte das "log" hier posten.

Michael.

Thorm[bd] · #12 Ungelesener Beitrag von **Thorm[bd]** » 19.10.2003 11:35

hier ist es ..ungekürzt

--- Opening Log file [October 18 15:10:26]

# Windows Console Edition #####################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################

[15:10:27] Configuring Folding@home...

[15:14:47] - Ask before connecting: No
[15:14:47] - User name: Thorm (Team 1737048435)
[15:14:47] - User ID not found locally
[15:14:47] + Requesting User ID from server
[15:14:52] - Machine ID: 1
[15:14:52]
[15:14:52] Work directory not found. Creating...
[15:14:52] Could not open work queue, generating new queue...
[15:14:52] + Benchmarking ...
[15:14:55] + Attempting to get work packet
[15:14:55] - Connecting to assignment server
[15:14:56] - Successful: assigned to (171.64.122.125).
[15:14:56] + News From Folding@Home: Welcome to Folding@Home
[15:14:56] Loaded queue successfully.
[15:14:57] - Deadline time not received.
[15:14:58] + Closed connections
[15:14:58]
[15:14:58] + Processing work unit
[15:14:58] Core required: FahCore_ca.exe
[15:14:58] Core not found.
[15:14:58] - Core is not present or corrupted.
[15:14:58] - Attempting to download new core...
[15:14:58] + Downloading new core: FahCore_ca.exe
[15:14:59] + 10240 bytes downloaded
[15:14:59] + 20480 bytes downloaded
[15:14:59] + 30720 bytes downloaded
[15:15:00] + 40960 bytes downloaded
[15:15:00] + 51200 bytes downloaded
[15:15:00] + 61440 bytes downloaded
[15:15:00] + 71680 bytes downloaded
[15:15:00] + 81920 bytes downloaded
[15:15:00] + 92160 bytes downloaded
[15:15:00] + 102400 bytes downloaded
[15:15:00] + 112640 bytes downloaded
[15:15:01] + 122880 bytes downloaded
[15:15:01] + 133120 bytes downloaded
[15:15:01] + 143360 bytes downloaded
[15:15:01] + 153600 bytes downloaded
[15:15:01] + 163840 bytes downloaded
[15:15:01] + 174080 bytes downloaded
[15:15:01] + 184320 bytes downloaded
[15:15:02] + 194560 bytes downloaded
[15:15:02] + 204800 bytes downloaded
[15:15:02] + 215040 bytes downloaded
[15:15:02] + 225280 bytes downloaded
[15:15:02] + 235520 bytes downloaded
[15:15:02] + 245760 bytes downloaded
[15:15:02] + 256000 bytes downloaded
[15:15:02] + 266240 bytes downloaded
[15:15:03] + 276480 bytes downloaded
[15:15:03] + 286720 bytes downloaded
[15:15:03] + 296960 bytes downloaded
[15:15:03] + 307200 bytes downloaded
[15:15:03] + 317440 bytes downloaded
[15:15:03] + 327680 bytes downloaded
[15:15:03] + 337920 bytes downloaded
[15:15:04] + 348160 bytes downloaded
[15:15:04] + 358400 bytes downloaded
[15:15:04] + 368640 bytes downloaded
[15:15:04] + 378880 bytes downloaded
[15:15:04] + 389120 bytes downloaded
[15:15:04] + 399360 bytes downloaded
[15:15:04] + 409600 bytes downloaded
[15:15:04] + 419840 bytes downloaded
[15:15:05] + 430080 bytes downloaded
[15:15:05] + 440320 bytes downloaded
[15:15:05] + 450560 bytes downloaded
[15:15:05] + 460800 bytes downloaded
[15:15:05] + 471040 bytes downloaded
[15:15:05] + 480026 bytes downloaded
[15:15:05] Verifying core Core_ca.fah...
[15:15:05] Signature is VALID
[15:15:05] Created: Wednesday April 10, 2002 00:01:22 UTC
[15:15:05] Signed: Monday March 3, 2003 00:18:15 UTC
[15:15:05]
[15:15:05] Trying to unzip core FahCore_ca.exe
[15:15:05] Decompressed FahCore_ca.exe (1466368 bytes) successfully
[15:15:06] + Core successfully engaged
[15:15:11]
[15:15:11] + Processing work unit
[15:15:11] Core required: FahCore_ca.exe
[15:15:11] Core found.
[15:15:11] Working on Unit 01 [October 18 15:15:11]
[15:15:11] + Working ...
[15:15:11] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[15:15:11]
[15:15:11] Proj: work/wudata_01
[15:15:11] Finding work files
[15:15:11] sizeof(CORE_PACKET_HDR) = 512
[15:15:11] Checking frame files
[15:15:11] - Couldn't open work/wudata_01.chk
[15:15:11] Starting from initial work packet
[15:15:11]
[15:15:11] Updating shared core-client information
[15:15:11] - Writing "work/wudata_01.key": (overwrite)successful.
[15:15:11] Key file to update shared file: work/wudata_01.key
[15:15:11] keyfile: 0 68 200 15 2 1 0
[15:15:11] Protein: SH3ligGH2/pdb1qwf.1.spa
[15:15:11] - Frames Completed: 0, Remaining: 600
[15:15:11] - Dynamic steps required: 120000
[15:15:11]
[15:15:11] Printed current.prm
[15:15:11] Writing local files:
[15:15:11] - Writing "work/wudata_01.key": (overwrite)successful.
[15:15:11] - Writing "work/wudata_01.xyz": (overwrite)successful.
[15:15:11] - Writing "work/wudata_01.prm": (overwrite)successful.
[15:15:12] Starting design engine
[15:15:12] [SPG] project name: work/wudata_01.
[15:15:12] [SPG] 1 0
[15:15:12] [SPG] Unrecognized atom
[15:15:12] [SPG] Unrecognized atom
[15:15:12] [SPG] Initializing protein design engine
[15:15:12] [SPG] seed = 0
[15:15:12] [SPG] Initialization complete
[15:15:12] [SPG] Writing current.pdb, chainlength = 68
[15:15:12] [SPG] Writing current.xyz
[15:15:12] [SPG] Preprocessing . . .
[15:15:12] [SPG] 68 positions in protein
[15:15:48] [SPG] Preprocessing complete
[15:15:48] Iterations: 0 of 600
[15:15:49] Finished
[15:15:49] [SPG] Native chi angles stored
[15:15:50] [SPG] Rotamers read
[15:15:50] [SPG] Unrecognized atom
[15:15:50] [SPG] Unrecognized atom
[15:15:50] [SPG] Starting genetic algorithm
[15:16:42] [SPG] seed: 6536792
[15:16:42] [SPG] Designing protein sequence 1 of 30
[15:19:19] [SPG] 10.0
[15:22:26] [SPG] 20.0
[15:25:05] [SPG] 30.0
[15:27:14] [SPG] 40.0
[15:29:08] [SPG] 50.0
[15:31:18] [SPG] 60.0
[15:32:26] [SPG] 70.0
[15:33:35] [SPG] 80.0
[15:34:47] [SPG] 90.0
[15:35:56] [SPG] 100.0
[15:35:56] [SPG] Writing current.xyz
[15:35:56] [SPG] Sequence 1 completed:
[15:35:56] KYYAKWPVNASTSNIYGVENGKPVRASNTTIGPYMLVYNPETGTWGYLPV . . .
[15:35:56] Iterations: 20 of 600
[15:35:57] Finished
[15:35:58] [SPG] seed: 13073584
[15:35:58] [SPG] Designing protein sequence 2 of 30
[15:37:30] [SPG] 10.0
[15:39:05] [SPG] 20.0
[15:40:33] [SPG] 30.0
[15:41:52] [SPG] 40.0
[15:43:08] [SPG] 50.0
[15:44:23] [SPG] 60.0
[15:45:36] [SPG] 70.0
[15:46:48] [SPG] 80.0
[15:47:58] [SPG] 90.0
[15:49:09] [SPG] 100.0
[15:49:09] [SPG] Writing current.xyz
[15:49:10] [SPG] Sequence 2 completed:
[15:49:10] KLYAKWPVNASTTLIKGMNSGLPIVSLNKQIGPVLLVWLPNEGELGYQYA . . .
[15:49:10] Iterations: 40 of 600
[15:49:11] Finished
[15:49:11] [SPG] seed: 19610376
[15:49:11] [SPG] Designing protein sequence 3 of 30
[15:50:47] [SPG] 10.0
[15:52:18] [SPG] 20.0
[15:53:41] [SPG] 30.0
[15:55:04] [SPG] 40.0
[15:56:20] [SPG] 50.0
[15:57:32] [SPG] 60.0
[15:58:42] [SPG] 70.0
[15:59:49] [SPG] 80.0
[16:00:53] [SPG] 90.0
[16:01:58] [SPG] 100.0
[16:01:58] [SPG] Writing current.xyz
[16:01:58] [SPG] Sequence 3 completed:
[16:01:58] ALVAQWPYSAPTSETWPVPSGFYVVPLNPTTGPILLVVDPQTGTVGYLPY . . .
[16:01:58] Iterations: 60 of 600
[16:01:59] Finished
[16:02:00] [SPG] seed: 26147168
[16:02:00] [SPG] Designing protein sequence 4 of 30
[16:03:31] [SPG] 10.0
[16:04:57] [SPG] 20.0
[16:06:18] [SPG] 30.0
[16:07:33] [SPG] 40.0
[16:08:44] [SPG] 50.0
[16:09:55] [SPG] 60.0
[16:11:03] [SPG] 70.0
[16:12:09] [SPG] 80.0
[16:13:16] [SPG] 90.0
[16:14:21] [SPG] 100.0
[16:14:21] [SPG] Writing current.xyz
[16:14:21] [SPG] Sequence 4 completed:
[16:14:21] YLAMQWPLNSASNSMYPANSGKVIVPIHPNEGPILLVWEPYSGTLGYVPV . . .
[16:14:21] Iterations: 80 of 600
[16:14:22] Finished
[16:14:23] [SPG] seed: 32683960
[16:14:23] [SPG] Designing protein sequence 5 of 30
[16:15:54] [SPG] 10.0
[16:17:22] [SPG] 20.0
[16:18:41] [SPG] 30.0
[16:19:57] [SPG] 40.0
[16:21:09] [SPG] 50.0
[16:22:23] [SPG] 60.0
[16:23:36] [SPG] 70.0
[16:24:51] [SPG] 80.0
[16:26:04] [SPG] 90.0
[16:27:11] [SPG] 100.0
[16:27:11] [SPG] Writing current.xyz
[16:27:11] [SPG] Sequence 5 completed:
[16:27:11] QAELRYPASASSASILGYTAGLKVTTKEPTVGVVLLTEIENTGTLGYLYK . . .
[16:27:11] Iterations: 100 of 600
[16:27:12] Finished
[16:27:13] [SPG] seed: 39220752
[16:27:13] [SPG] Designing protein sequence 6 of 30
[16:28:49] [SPG] 10.0
[16:30:38] [SPG] 20.0
[16:32:31] [SPG] 30.0
[16:34:18] [SPG] 40.0
[16:35:57] [SPG] 50.0
[16:37:29] [SPG] 60.0
[16:38:59] [SPG] 70.0
[16:40:30] [SPG] 80.0
[16:41:58] [SPG] 90.0
[16:43:24] [SPG] 100.0
[16:43:24] [SPG] Writing current.xyz
[16:43:24] [SPG] Sequence 6 completed:
[16:43:24] EMYAVWPYQASTNQTYGFTAGFVMVVIMEELGPIILVREPTKGTTGYFPK . . .
[16:43:25] Iterations: 120 of 600
[16:43:26] Finished
[16:43:27] [SPG] seed: 45757544
[16:43:27] [SPG] Designing protein sequence 7 of 30
[16:46:05] [SPG] 10.0
[16:47:58] [SPG] 20.0
[16:50:02] [SPG] 30.0
[16:51:55] [SPG] 40.0
[16:53:36] [SPG] 50.0
[16:55:22] [SPG] 60.0
[16:57:02] [SPG] 70.0
[16:58:23] [SPG] 80.0
[16:59:58] [SPG] 90.0
[17:01:42] [SPG] 100.0
[17:01:42] [SPG] Writing current.xyz
[17:01:42] [SPG] Sequence 7 completed:
[17:01:42] NYVMLWPYSSSSSSAWGPTSGLIILAZYTALGPIVYVQIPNTGTLGAVVK . . .
[17:01:42] Iterations: 140 of 600
[17:01:43] Finished
[17:01:44] [SPG] seed: 52294336
[17:01:44] [SPG] Designing protein sequence 8 of 30
[17:04:09] [SPG] 10.0
[17:06:19] [SPG] 20.0
[17:08:16] [SPG] 30.0
[17:10:14] [SPG] 40.0
[17:11:57] [SPG] 50.0
[17:13:35] [SPG] 60.0
[17:14:43] [SPG] 70.0
[17:15:48] [SPG] 80.0
[17:16:53] [SPG] 90.0
[17:18:00] [SPG] 100.0
[17:18:00] [SPG] Writing current.xyz
[17:18:00] [SPG] Sequence 8 completed:
[17:18:00] QLVAIYPVQAADSSIKGVNSGEYVYPIIKTVGVYVLVWDPETGTKGYLPW . . .
[17:18:00] Iterations: 160 of 600
[17:18:01] Finished
[17:18:01] [SPG] seed: 58831128
[17:18:01] [SPG] Designing protein sequence 9 of 30
[17:19:32] [SPG] 10.0
[17:21:20] [SPG] 20.0
[17:23:11] [SPG] 30.0
[17:24:21] [SPG] 40.0
[17:25:27] [SPG] 50.0
[17:26:32] [SPG] 60.0
[17:27:36] [SPG] 70.0
[17:28:39] [SPG] 80.0
[17:29:45] [SPG] 90.0
[17:30:55] [SPG] 100.0
[17:30:55] [SPG] Writing current.xyz
[17:30:55] [SPG] Sequence 9 completed:
[17:30:55] SYIAQWPVSSSTSSMWPVPSGFVVVSKEVNIGVIALVEDYETGTKGYLPV . . .
[17:30:55] Iterations: 180 of 600
[17:30:56] Finished
[17:30:57] [SPG] seed: 65367920
[17:30:57] [SPG] Designing protein sequence 10 of 30
[17:32:37] [SPG] 10.0
[17:34:12] [SPG] 20.0
[17:35:36] [SPG] 30.0
[17:36:59] [SPG] 40.0
[17:38:12] [SPG] 50.0
[17:39:19] [SPG] 60.0
[17:40:26] [SPG] 70.0
[17:41:32] [SPG] 80.0
[17:42:38] [SPG] 90.0
[17:43:41] [SPG] 100.0
[17:43:41] [SPG] Writing current.xyz
[17:43:41] [SPG] Sequence 10 completed:
[17:43:41] TLIAQTAVNSATTQMFPYQPGLYIIPRNPNVGPILFTTLPNNGSVGYIPY . . .
[17:43:41] Iterations: 200 of 600
[17:43:42] Finished
[17:43:43] [SPG] seed: 71904712
[17:43:43] [SPG] Designing protein sequence 11 of 30
[17:45:10] [SPG] 10.0
[17:46:33] [SPG] 20.0
[17:47:49] [SPG] 30.0
[17:49:02] [SPG] 40.0
[17:50:12] [SPG] 50.0
[17:51:20] [SPG] 60.0
[17:52:26] [SPG] 70.0
[17:53:33] [SPG] 80.0
[17:54:40] [SPG] 90.0
[17:55:47] [SPG] 100.0
[17:55:47] [SPG] Writing current.xyz
[17:55:47] [SPG] Sequence 11 completed:
[17:55:47] QLKAKWPLTSTSSTMIGVTSGKIVRPLLLELGVILKVVLEYPGQKGYIML . . .
[17:55:47] Iterations: 220 of 600
[17:55:48] Finished
[17:55:48] [SPG] seed: 78441504
[17:55:48] [SPG] Designing protein sequence 12 of 30
[17:57:15] [SPG] 10.0
[17:58:37] [SPG] 20.0
[17:59:55] [SPG] 30.0
[18:01:07] [SPG] 40.0
[18:02:17] [SPG] 50.0
[18:03:25] [SPG] 60.0
[18:04:34] [SPG] 70.0
[18:05:43] [SPG] 80.0
[18:06:49] [SPG] 90.0
[18:07:54] [SPG] 100.0
[18:07:54] [SPG] Writing current.xyz
[18:07:54] [SPG] Sequence 12 completed:
[18:07:54] NLIAKWAVNSTTSSMLGFPPGFVIVPKRRTQGNILYAVQPETGTQGAIPV . . .
[18:07:54] Iterations: 240 of 600
[18:07:55] Finished
[18:07:55] [SPG] seed: 84978296
[18:07:55] [SPG] Designing protein sequence 13 of 30
[18:09:24] [SPG] 10.0
[18:10:48] [SPG] 20.0
[18:12:07] [SPG] 30.0
[18:13:20] [SPG] 40.0
[18:14:28] [SPG] 50.0
[18:15:35] [SPG] 60.0
[18:16:40] [SPG] 70.0
[18:17:45] [SPG] 80.0
[18:18:49] [SPG] 90.0
[18:19:53] [SPG] 100.0
[18:19:53] [SPG] Writing current.xyz
[18:19:53] [SPG] Sequence 13 completed:
[18:19:53] RLEMKWPLQSSSSSMYPFVAGLQVQKJEVAVGPVFFAWLPKTGVPGYAMW . . .
[18:19:53] Iterations: 260 of 600
[18:19:54] Finished
[18:19:55] [SPG] seed: 91515088
[18:19:55] [SPG] Designing protein sequence 14 of 30
[18:21:23] [SPG] 10.0
[18:22:44] [SPG] 20.0
[18:24:02] [SPG] 30.0
[18:25:14] [SPG] 40.0
[18:26:23] [SPG] 50.0
[18:27:31] [SPG] 60.0
[18:28:38] [SPG] 70.0
[18:29:45] [SPG] 80.0
[18:30:52] [SPG] 90.0
[18:31:58] [SPG] 100.0
[18:31:58] [SPG] Writing current.xyz
[18:31:58] [SPG] Sequence 14 completed:
[18:31:58] NLKLKWSVSSTTSSMFGFNPGVVVYKVIPNVGPILKVEQTYTGVDGYIPK . . .
[18:31:58] Iterations: 280 of 600
[18:31:59] Finished
[18:32:00] [SPG] seed: 98051880
[18:32:00] [SPG] Designing protein sequence 15 of 30
[18:33:27] [SPG] 10.0
[18:34:48] [SPG] 20.0
[18:36:01] [SPG] 30.0
[18:37:09] [SPG] 40.0
[18:38:11] [SPG] 50.0
[18:39:14] [SPG] 60.0
[18:40:16] [SPG] 70.0
[18:41:17] [SPG] 80.0
[18:42:16] [SPG] 90.0
[18:43:14] [SPG] 100.0
[18:43:14] [SPG] Writing current.xyz
[18:43:15] [SPG] Sequence 15 completed:
[18:43:15] QMKLIWAVAAATSAIMGAVPGLYVKKLDPSIGPVLLVVLPRTGTLGYMFK . . .
[18:43:15] Iterations: 300 of 600
[18:43:16] Finished
[18:43:17] [SPG] seed: 104588672
[18:43:17] [SPG] Designing protein sequence 16 of 30
[18:44:19] [SPG] 10.0
[18:45:21] [SPG] 20.0
[18:46:23] [SPG] 30.0
[18:47:27] [SPG] 40.0
[18:48:30] [SPG] 50.0
[18:49:33] [SPG] 60.0
[18:50:36] [SPG] 70.0
[18:51:39] [SPG] 80.0
[18:52:42] [SPG] 90.0
[18:53:44] [SPG] 100.0
[18:53:44] [SPG] Writing current.xyz
[18:53:44] [SPG] Sequence 16 completed:
[18:53:44] NLELIWPYQSSSSSALPYPSGFIVVPLNPTVGPILYTWDPETGTKGAVPV . . .
[18:53:45] Iterations: 320 of 600
[18:53:46] Finished
[18:53:46] [SPG] seed: 111125464
[18:53:46] [SPG] Designing protein sequence 17 of 30
[18:54:48] [SPG] 10.0
[18:55:48] [SPG] 20.0
[18:56:49] [SPG] 30.0
[18:57:50] [SPG] 40.0
[18:58:51] [SPG] 50.0
[18:59:53] [SPG] 60.0
[19:00:55] [SPG] 70.0
[19:01:56] [SPG] 80.0
[19:02:58] [SPG] 90.0
[19:04:00] [SPG] 100.0
[19:04:00] [SPG] Writing current.xyz
[19:04:00] [SPG] Sequence 17 completed:
[19:04:00] YLIAIWPYQSSSSSALPYPSGFVMVPLNPTVGPILYTWDPETGTKGAVPK . . .
[19:04:00] Iterations: 340 of 600
[19:04:01] Finished
[19:04:02] [SPG] seed: 117662256
[19:04:02] [SPG] Designing protein sequence 18 of 30
[19:05:04] [SPG] 10.0
[19:06:05] [SPG] 20.0
[19:07:08] [SPG] 30.0
[19:08:11] [SPG] 40.0
[19:09:14] [SPG] 50.0
[19:10:17] [SPG] 60.0
[19:11:20] [SPG] 70.0
[19:12:23] [SPG] 80.0
[19:13:25] [SPG] 90.0
[19:14:28] [SPG] 100.0
[19:14:28] [SPG] Writing current.xyz
[19:14:28] [SPG] Sequence 18 completed:
[19:14:28] YLEAIWPYQSSSSSALPYPSGFIMVPLNPTVGPILYTWDPETGTKGAVPW . . .
[19:14:28] Iterations: 360 of 600
[19:14:29] Finished
[19:14:29] [SPG] seed: 124199048
[19:14:29] [SPG] Designing protein sequence 19 of 30
[19:15:31] [SPG] 10.0
[19:16:31] [SPG] 20.0
[19:17:32] [SPG] 30.0
[19:18:33] [SPG] 40.0
[19:19:34] [SPG] 50.0
[19:20:36] [SPG] 60.0
[19:21:38] [SPG] 70.0
[19:22:40] [SPG] 80.0
[19:23:41] [SPG] 90.0
[19:24:43] [SPG] 100.0
[19:24:43] [SPG] Writing current.xyz
[19:24:43] [SPG] Sequence 19 completed:
[19:24:43] QLYAIWPVQSPTSSMLPYPSGFVMVPJNPTVGPILYTWDPETGTLGAIPW . . .
[19:24:43] Iterations: 380 of 600
[19:24:44] Finished
[19:24:45] [SPG] seed: 130735840
[19:24:45] [SPG] Designing protein sequence 20 of 30
[19:25:47] [SPG] 10.0
[19:26:47] [SPG] 20.0
[19:27:48] [SPG] 30.0
[19:28:49] [SPG] 40.0
[19:29:50] [SPG] 50.0
[19:30:52] [SPG] 60.0
[19:31:54] [SPG] 70.0
[19:32:56] [SPG] 80.0
[19:33:58] [SPG] 90.0
[19:35:00] [SPG] 100.0
[19:35:00] [SPG] Writing current.xyz
[19:35:00] [SPG] Sequence 20 completed:
[19:35:00] QLVAIWPVNSSTSQMLPYPSGFYMVPJNPTVGPILYTWDPETGTLGAIPW . . .
[19:35:00] Iterations: 400 of 600
[19:35:01] Finished
[19:35:02] [SPG] seed: 137272632
[19:35:02] [SPG] Designing protein sequence 21 of 30
[19:36:04] [SPG] 10.0
[19:37:06] [SPG] 20.0
[19:38:11] [SPG] 30.0
[19:39:15] [SPG] 40.0
[19:40:19] [SPG] 50.0
[19:41:23] [SPG] 60.0
[19:42:29] [SPG] 70.0
[19:43:39] [SPG] 80.0
[19:44:51] [SPG] 90.0
[19:46:01] [SPG] 100.0
[19:46:01] [SPG] Writing current.xyz
[19:46:02] [SPG] Sequence 21 completed:
[19:46:02] QYKLIWPYQSSTSQALPYPSGFYVVALNPTVGPIVYTWDPETGTKGAVPW . . .
[19:46:03] Iterations: 420 of 600
[19:46:04] Finished
[19:46:04] [SPG] seed: 143809424
[19:46:04] [SPG] Designing protein sequence 22 of 30

Folding@home Client Shutdown.

--- Opening Log file [October 18 22:14:23]

# Windows Console Edition #####################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################

[22:14:23] - Ask before connecting: No
[22:14:23] - User name: Thorm (Team 1737048435)
[22:14:23] - User ID = 2A33F94403AE6B73
[22:14:23] - Machine ID: 1
[22:14:23]
[22:14:23] Loaded queue successfully.
[22:14:23] + Benchmarking ...
[22:14:26]
[22:14:26] + Processing work unit
[22:14:26] Core required: FahCore_ca.exe
[22:14:26] Core found.
[22:14:26] Working on Unit 01 [October 18 22:14:26]
[22:14:26] + Working ...
[22:14:26] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[22:14:26]
[22:14:26] Proj: work/wudata_01
[22:14:26] Finding work files
[22:14:26] sizeof(CORE_PACKET_HDR) = 512
[22:14:26] Checking frame files
[22:14:27] Restarting from checkpointed files.
[22:14:27]
[22:14:27] Protein: SH3ligGH2/pdb1qwf.1.spa
[22:14:27] - Frames Completed: 420, Remaining: 180
[22:14:27] - Dynamic steps required: 36000
[22:14:27]
[22:14:28] Printed current.prm
[22:14:28] Writing local files:
[22:14:28] - Writing "work/wudata_01.key": (overwrite)successful.
[22:14:28] - Writing "work/wudata_01.xyz": (overwrite)successful.
[22:14:28] - Writing "work/wudata_01.prm": (overwrite)successful.
[22:14:28] Starting design engine
[22:14:28] [SPG] project name: work/wudata_01.
[22:14:28] [SPG] 2 6
[22:14:28] [SPG] Unrecognized atom
[22:14:28] [SPG] Unrecognized atom
[22:14:28] [SPG] Initializing protein design engine
[22:14:28] [SPG] seed = 6536792
[22:14:28] [SPG] Initialization complete
[22:14:28] [SPG] Writing current.pdb, chainlength = 68
[22:14:28] [SPG] Writing current.xyz
[22:14:29] [SPG] Preprocessing . . .
[22:14:29] [SPG] 68 positions in protein
[22:15:00] [SPG] Preprocessing complete
[22:15:00] Iterations: 420 of 600
[22:15:01] Finished
[22:15:02] [SPG] Native chi angles stored
[22:15:02] [SPG] Rotamers read
[22:15:02] [SPG] Unrecognized atom
[22:15:02] [SPG] Unrecognized atom
[22:15:02] [SPG] Starting genetic algorithm
[22:15:43] [SPG] seed: 143809424
[22:15:43] [SPG] Designing protein sequence 22 of 30
[22:17:09] [SPG] 10.0
[22:18:29] [SPG] 20.0
[22:19:46] [SPG] 30.0
[22:20:57] [SPG] 40.0
[22:22:04] [SPG] 50.0
[22:23:08] [SPG] 60.0
[22:24:11] [SPG] 70.0
[22:25:15] [SPG] 80.0
[22:26:17] [SPG] 90.0
[22:27:19] [SPG] 100.0
[22:27:19] [SPG] Writing current.xyz
[22:27:19] [SPG] Sequence 22 completed:
[22:27:19] SLVALWPLPSSTSSILGMPTGFWIRLIHPNQGPILFVKVPETGEHGYFPV . . .
[22:27:20] Iterations: 440 of 600
[22:27:21] Finished
[22:27:21] [SPG] seed: 150346216
[22:27:21] [SPG] Designing protein sequence 23 of 30
[22:28:47] [SPG] 10.0
[22:30:07] [SPG] 20.0
[22:31:20] [SPG] 30.0
[22:32:31] [SPG] 40.0
[22:33:36] [SPG] 50.0
[22:34:39] [SPG] 60.0
[22:35:40] [SPG] 70.0
[22:36:43] [SPG] 80.0
[22:37:46] [SPG] 90.0
[22:38:51] [SPG] 100.0
[22:38:51] [SPG] Writing current.xyz
[22:38:51] [SPG] Sequence 23 completed:
[22:38:51] NLVFIWPVQSATSLMLGFTSGQIATKIDTTIGVIFLAIDRYTGTEGYAPI . . .
[22:38:51] Iterations: 460 of 600
[22:38:52] Finished
[22:38:52] [SPG] seed: 156883008
[22:38:52] [SPG] Designing protein sequence 24 of 30
[22:40:19] [SPG] 10.0
[22:41:41] [SPG] 20.0
[22:42:59] [SPG] 30.0
[22:44:11] [SPG] 40.0
[22:45:17] [SPG] 50.0
[22:46:21] [SPG] 60.0
[22:47:25] [SPG] 70.0
[22:48:26] [SPG] 80.0
[22:49:27] [SPG] 90.0
[22:50:27] [SPG] 100.0
[22:50:27] [SPG] Writing current.xyz
[22:50:27] [SPG] Sequence 24 completed:
[22:50:27] SLKAQWPVDSATSAILGVVSGLYVKKLNTNVGPIVYIVLPETGTWGAAPW . . .
[22:50:28] Iterations: 480 of 600
[22:50:29] Finished
[22:50:29] [SPG] seed: 163419800
[22:50:29] [SPG] Designing protein sequence 25 of 30
[22:51:56] [SPG] 10.0
[22:53:20] [SPG] 20.0
[22:54:39] [SPG] 30.0
[22:55:52] [SPG] 40.0
[22:57:01] [SPG] 50.0
[22:58:09] [SPG] 60.0
[22:59:17] [SPG] 70.0
[23:00:23] [SPG] 80.0
[23:01:28] [SPG] 90.0
[23:02:32] [SPG] 100.0
[23:02:32] [SPG] Writing current.xyz
[23:02:32] [SPG] Sequence 25 completed:
[23:02:32] AMYMQWSFSATTTQVLGMTSGKLVVPIEPSVGPYLLVVLYKTGTKGYAAW . . .
[23:02:32] Iterations: 500 of 600
[23:02:33] Finished
[23:02:34] [SPG] seed: 169956592
[23:02:34] [SPG] Designing protein sequence 26 of 30
[23:03:59] [SPG] 10.0
[23:05:16] [SPG] 20.0
[23:06:28] [SPG] 30.0
[23:07:38] [SPG] 40.0
[23:08:43] [SPG] 50.0
[23:09:47] [SPG] 60.0
[23:10:51] [SPG] 70.0
[23:11:55] [SPG] 80.0
[23:12:59] [SPG] 90.0
[23:14:04] [SPG] 100.0
[23:14:04] [SPG] Writing current.xyz
[23:14:04] [SPG] Sequence 26 completed:
[23:14:04] QJVAEYPYPATTSSTYPVNAGYIVVPLDTTIGPYFLAQVYTTGQKGYLPK . . .
[23:14:04] Iterations: 520 of 600
[23:14:05] Finished
[23:14:06] [SPG] seed: 176493384
[23:14:06] [SPG] Designing protein sequence 27 of 30
[23:15:33] [SPG] 10.0
[23:16:57] [SPG] 20.0
[23:18:16] [SPG] 30.0
[23:19:26] [SPG] 40.0
[23:20:31] [SPG] 50.0
[23:21:36] [SPG] 60.0
[23:22:40] [SPG] 70.0
[23:23:43] [SPG] 80.0
[23:24:47] [SPG] 90.0
[23:25:49] [SPG] 100.0
[23:25:49] [SPG] Writing current.xyz
[23:25:49] [SPG] Sequence 27 completed:
[23:25:49] FAIMQYPLNAETSTIWGPVQGFVIYPVIPNVGVVLFVVDPETGTPGYVMT . . .
[23:25:49] Iterations: 540 of 600
[23:25:50] Finished
[23:25:51] [SPG] seed: 183030176
[23:25:51] [SPG] Designing protein sequence 28 of 30
[23:27:17] [SPG] 10.0
[23:28:38] [SPG] 20.0
[23:29:53] [SPG] 30.0
[23:31:02] [SPG] 40.0
[23:32:08] [SPG] 50.0
[23:33:13] [SPG] 60.0
[23:34:17] [SPG] 70.0
[23:35:21] [SPG] 80.0
[23:36:26] [SPG] 90.0
[23:37:32] [SPG] 100.0
[23:37:32] [SPG] Writing current.xyz
[23:37:32] [SPG] Sequence 28 completed:
[23:37:32] RKVLVWPVNSPSASIYPYPSGEIVNLIQLSLGPIALTTLNNEGVNGYIPY . . .
[23:37:32] Iterations: 560 of 600
[23:37:33] Finished
[23:37:34] [SPG] seed: 189566968
[23:37:34] [SPG] Designing protein sequence 29 of 30
[23:39:01] [SPG] 10.0
[23:40:24] [SPG] 20.0
[23:41:40] [SPG] 30.0
[23:42:51] [SPG] 40.0
[23:43:59] [SPG] 50.0
[23:45:06] [SPG] 60.0
[23:46:13] [SPG] 70.0
[23:47:19] [SPG] 80.0
[23:48:27] [SPG] 90.0
[23:49:34] [SPG] 100.0
[23:49:34] [SPG] Writing current.xyz
[23:49:34] [SPG] Sequence 29 completed:
[23:49:34] ELYLIWSVNSSTSEMYGYVPGLVAVRLNTTVGDVAVTVLPETGVRGYVYY . . .
[23:49:34] Iterations: 580 of 600
[23:49:35] Finished
[23:49:36] [SPG] seed: 196103760
[23:49:36] [SPG] Designing protein sequence 30 of 30
[23:51:03] [SPG] 10.0
[23:52:26] [SPG] 20.0
[23:53:44] [SPG] 30.0
[23:54:55] [SPG] 40.0
[23:56:03] [SPG] 50.0
[23:57:11] [SPG] 60.0
[23:58:21] [SPG] 70.0
[23:59:31] [SPG] 80.0
[00:00:40] [SPG] 90.0
[00:01:49] [SPG] 100.0
[00:01:49] [SPG] Writing current.xyz
[00:01:49] [SPG] Sequence 30 completed:
[00:01:49] HYYAKWPVNSSTSNIYPYESGKVIKAKKLNVGVILLAENPETGTPGYVPK . . .
[00:01:49] Iterations: 600 of 600
[00:01:50] Finished
[00:01:51] [SPG] Design complete
[00:01:51] [SPG] completed successfully
[00:01:52]
[00:01:52] Finished Work Unit
[00:01:52] work_hdr.len_arcfile: 112200
[00:01:53] Leaving Run
[00:01:55] - Writing 112712 bytes of core data to disk.
[00:01:55] end (WriteWorkResults)
[00:01:55] - Shutting down core
[00:01:55]
[00:01:55] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[00:01:58] CoreStatus = 64 (100)
[00:01:58] Sending work to server

[00:01:58] + Attempting to send results
[00:01:58] - Couldn't send HTTP request to server
[00:01:58] + Could not connect to Work Server (results)
[00:01:58] - Error: Could not transmit unit 01 (completed October 19). Keeping unit in queue.

[00:01:58] + Attempting to send results
[00:01:58] - Couldn't send HTTP request to server
[00:01:58] + Could not connect to Work Server (results)
[00:01:58] - Error: Could not transmit unit 01 (completed October 19). Keeping unit in queue.
[00:01:58] + Attempting to get work packet
[00:01:58] - Connecting to assignment server
[00:01:58] + Could not connect to Assignment Server
[00:01:58] + Could not connect to Assignment Server 2
[00:01:58] + Couldn't get work instructions.
[00:01:58] - Error: Getwork #1 failed, and no other work to do. Waiting before retry
[00:02:07] + Attempting to get work packet
[00:02:07] - Connecting to assignment server
[00:02:07] + Could not connect to Assignment Server
[00:02:07] + Could not connect to Assignment Server 2
[00:02:07] + Couldn't get work instructions.
[00:02:07] - Error: Getwork #2 failed, and no other work to do. Waiting before retry
[00:02:28] + Attempting to get work packet
[00:02:28] - Connecting to assignment server
[00:02:28] + Could not connect to Assignment Server
[00:02:28] + Could not connect to Assignment Server 2
[00:02:28] + Couldn't get work instructions.
[00:02:28] - Error: Getwork #3 failed, and no other work to do. Waiting before retry
[00:02:53] + Attempting to get work packet
[00:02:53] - Connecting to assignment server
[00:02:53] + Could not connect to Assignment Server
[00:02:53] + Could not connect to Assignment Server 2
[00:02:53] + Couldn't get work instructions.
[00:02:53] - Error: Getwork #4 failed, and no other work to do. Waiting before retry
[00:03:41] + Attempting to get work packet
[00:03:41] - Connecting to assignment server
[00:03:41] + Could not connect to Assignment Server
[00:03:41] + Could not connect to Assignment Server 2
[00:03:41] + Couldn't get work instructions.
[00:03:41] - Error: Getwork #5 failed, and no other work to do. Waiting before retry
[00:05:03] + Attempting to get work packet
[00:05:03] - Connecting to assignment server
[00:05:03] + Could not connect to Assignment Server
[00:05:03] + Could not connect to Assignment Server 2
[00:05:03] + Couldn't get work instructions.
[00:05:03] - Error: Getwork #6 failed, and no other work to do. Waiting before retry
[00:07:54] + Attempting to get work packet
[00:07:54] - Connecting to assignment server
[00:07:54] + Could not connect to Assignment Server
[00:07:54] + Could not connect to Assignment Server 2
[00:07:54] + Couldn't get work instructions.
[00:07:54] - Error: Getwork #7 failed, and no other work to do. Waiting before retry
[00:13:17] + Attempting to get work packet
[00:13:17] - Connecting to assignment server
[00:13:17] + Could not connect to Assignment Server
[00:13:17] + Could not connect to Assignment Server 2
[00:13:17] + Couldn't get work instructions.
[00:13:17] - Error: Getwork #8 failed, and no other work to do. Waiting before retry
[00:24:08] + Attempting to get work packet
[00:24:08] - Connecting to assignment server
[00:24:08] + Could not connect to Assignment Server
[00:24:08] + Could not connect to Assignment Server 2
[00:24:08] + Couldn't get work instructions.
[00:24:08] - Error: Getwork #9 failed, and no other work to do. Waiting before retry
[00:45:31] + Attempting to get work packet
[00:45:31] - Connecting to assignment server
[00:45:31] + Could not connect to Assignment Server
[00:45:31] + Could not connect to Assignment Server 2
[00:45:31] + Couldn't get work instructions.
[00:45:31] - Error: Getwork #10 failed, and no other work to do. Waiting before retry
[01:28:12] + Attempting to get work packet
[01:28:12] - Connecting to assignment server
[01:28:12] + Could not connect to Assignment Server
[01:28:12] + Could not connect to Assignment Server 2
[01:28:12] + Couldn't get work instructions.
[01:28:12] - Error: Getwork #11 failed, and no other work to do. Waiting before retry
[02:16:18] + Attempting to get work packet
[02:16:18] - Connecting to assignment server
[02:16:18] + Could not connect to Assignment Server
[02:16:18] + Could not connect to Assignment Server 2
[02:16:18] + Couldn't get work instructions.
[02:16:18] - Error: Getwork #12 failed, and no other work to do. Waiting before retry
[03:04:25] + Attempting to get work packet
[03:04:25] - Connecting to assignment server
[03:04:25] + Could not connect to Assignment Server
[03:04:25] + Could not connect to Assignment Server 2
[03:04:25] + Couldn't get work instructions.
[03:04:25] - Error: Getwork #13 failed, and no other work to do. Waiting before retry
[03:52:28] + Attempting to get work packet
[03:52:28] - Connecting to assignment server
[03:52:28] + Could not connect to Assignment Server
[03:52:28] + Could not connect to Assignment Server 2
[03:52:28] + Couldn't get work instructions.
[03:52:28] - Error: Getwork #14 failed, and no other work to do. Waiting before retry

[04:14:26] + Attempting to send results
[04:14:26] - Couldn't send HTTP request to server
[04:14:26] + Could not connect to Work Server (results)
[04:14:26] - Error: Could not transmit unit 01 (completed October 19). Keeping unit in queue.
[04:40:37] + Attempting to get work packet
[04:40:37] - Connecting to assignment server
[04:40:37] + Could not connect to Assignment Server
[04:40:37] + Could not connect to Assignment Server 2
[04:40:37] + Couldn't get work instructions.
[04:40:37] - Error: Getwork #15 failed, and no other work to do. Waiting before retry
[05:28:41] + Attempting to get work packet
[05:28:41] - Connecting to assignment server
[05:28:41] + Could not connect to Assignment Server
[05:28:41] + Could not connect to Assignment Server 2
[05:28:41] + Couldn't get work instructions.
[05:28:41] - Error: Getwork #16 failed, and no other work to do. Waiting before retry
[06:16:41] + Attempting to get work packet
[06:16:41] - Connecting to assignment server
[06:16:41] + Could not connect to Assignment Server
[06:16:41] + Could not connect to Assignment Server 2
[06:16:41] + Couldn't get work instructions.
[06:16:41] - Error: Getwork #17 failed, and no other work to do. Waiting before retry
[07:04:48] + Attempting to get work packet
[07:04:48] - Connecting to assignment server
[07:04:48] + Could not connect to Assignment Server
[07:04:48] + Could not connect to Assignment Server 2
[07:04:48] + Couldn't get work instructions.
[07:04:48] - Error: Getwork #18 failed, and no other work to do. Waiting before retry
[07:52:53] + Attempting to get work packet
[07:52:53] - Connecting to assignment server
[07:52:53] + Could not connect to Assignment Server
[07:52:53] + Could not connect to Assignment Server 2
[07:52:53] + Couldn't get work instructions.
[07:52:53] - Error: Getwork #19 failed, and no other work to do. Waiting before retry
[08:40:53] + Attempting to get work packet
[08:40:53] - Connecting to assignment server
[08:40:53] + Could not connect to Assignment Server
[08:40:53] + Could not connect to Assignment Server 2
[08:40:53] + Couldn't get work instructions.
[08:40:53] - Error: Getwork #20 failed, and no other work to do. Waiting before retry
[09:29:08] + Attempting to get work packet
[09:29:08] - Connecting to assignment server
[09:29:08] + Could not connect to Assignment Server
[09:29:08] + Could not connect to Assignment Server 2
[09:29:08] + Couldn't get work instructions.
[09:29:08] - Error: Getwork #21 failed, and no other work to do. Waiting before retry

Folding@home Client Shutdown.

--- Opening Log file [October 19 09:36:45]

# Windows Console Edition #####################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################

[09:36:45] - Ask before connecting: No
[09:36:45] - User name: Thorm (Team 1737048435)
[09:36:45] - User ID = 2A33F94403AE6B73
[09:36:45] - Machine ID: 1
[09:36:45]
[09:36:45] Loaded queue successfully.
[09:36:45] + Benchmarking ...
[09:36:48] + Attempting to get work packet
[09:36:48] - Connecting to assignment server

[09:36:48] + Attempting to send results
[09:36:49] - Successful: assigned to (171.64.122.125).
[09:36:49] + News From Folding@Home: Welcome to Folding@Home
[09:36:49] Loaded queue successfully.
[09:36:52] - Deadline time not received.
[09:36:54] + Results successfully sent
[09:36:54] Thank you for your contribution to Folding@home.
[09:36:54] + Starting local stats count at 1
[09:36:54] + Closed connections
[09:36:54]
[09:36:54] + Processing work unit
[09:36:54] Core required: FahCore_ca.exe
[09:36:54] Core found.
[09:36:54] Working on Unit 02 [October 19 09:36:54]
[09:36:54] + Working ...
[09:36:54] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[09:36:54]
[09:36:54] Proj: work/wudata_02
[09:36:54] Finding work files
[09:36:54] sizeof(CORE_PACKET_HDR) = 512
[09:36:54] Checking frame files
[09:36:54] - Couldn't open work/wudata_02.chk
[09:36:54] Starting from initial work packet
[09:36:54]
[09:36:54] Updating shared core-client information
[09:36:54] - Writing "work/wudata_02.key": (overwrite)successful.
[09:36:54] Key file to update shared file: work/wudata_02.key
[09:36:54] keyfile: 0 68 200 15 2 1 0
[09:36:54] Protein: SH3ligGH2/pdb1qwf.1.spa
[09:36:54] - Frames Completed: 0, Remaining: 600
[09:36:54] - Dynamic steps required: 120000
[09:36:54]
[09:36:55] Printed current.prm
[09:36:55] Writing local files:
[09:36:55] - Writing "work/wudata_02.key": (overwrite)successful.
[09:36:55] - Writing "work/wudata_02.xyz": (overwrite)successful.
[09:36:55] - Writing "work/wudata_02.prm": (overwrite)successful.
[09:36:55] Starting design engine
[09:36:55] [SPG] project name: work/wudata_02.
[09:36:55] [SPG] 1 0
[09:36:55] [SPG] Unrecognized atom
[09:36:55] [SPG] Unrecognized atom
[09:36:55] [SPG] Initializing protein design engine
[09:36:55] [SPG] seed = 0
[09:36:55] [SPG] Initialization complete
[09:36:55] [SPG] Writing current.pdb, chainlength = 68
[09:36:55] [SPG] Writing current.xyz
[09:36:55] [SPG] Preprocessing . . .
[09:36:55] [SPG] 68 positions in protein
[09:37:27] [SPG] Preprocessing complete
[09:37:27] Iterations: 0 of 600
[09:37:28] Finished
[09:37:28] [SPG] Native chi angles stored
[09:37:29] [SPG] Rotamers read
[09:37:29] [SPG] Unrecognized atom
[09:37:29] [SPG] Unrecognized atom
[09:37:29] [SPG] Starting genetic algorithm
[09:38:10] [SPG] seed: 5927804
[09:38:10] [SPG] Designing protein sequence 1 of 30
[09:39:39] [SPG] 10.0
[09:41:09] [SPG] 20.0
[09:42:36] [SPG] 30.0
[09:43:51] [SPG] 40.0
[09:45:00] [SPG] 50.0
[09:46:06] [SPG] 60.0
[09:47:10] [SPG] 70.0
[09:48:12] [SPG] 80.0
[09:49:15] [SPG] 90.0
[09:50:17] [SPG] 100.0
[09:50:17] [SPG] Writing current.xyz
[09:50:17] [SPG] Sequence 1 completed:
[09:50:17] SLAAIWPVQATDSTIIGTVQGFVLVPJEPRLGPVLFVLIYTEGSVGYLFI . . .
[09:50:17] Iterations: 20 of 600
[09:50:18] Finished
[09:50:19] [SPG] seed: 11855608
[09:50:19] [SPG] Designing protein sequence 2 of 30
[09:51:50] [SPG] 10.0
[09:53:14] [SPG] 20.0
[09:54:28] [SPG] 30.0
[09:55:38] [SPG] 40.0
[09:56:46] [SPG] 50.0
[09:57:52] [SPG] 60.0
[09:58:58] [SPG] 70.0
[10:00:03] [SPG] 80.0
[10:01:08] [SPG] 90.0
[10:02:14] [SPG] 100.0
[10:02:14] [SPG] Writing current.xyz
[10:02:14] [SPG] Sequence 2 completed:
[10:02:14] QZIAIWPVNSASNKMYPFPSGKYAQPLEESIGPILYVVDPTTGTKGALPW . . .
[10:02:14] Iterations: 40 of 600
[10:02:15] Finished
[10:02:16] [SPG] seed: 17783412
[10:02:16] [SPG] Designing protein sequence 3 of 30
[10:03:42] [SPG] 10.0
[10:05:02] [SPG] 20.0
[10:06:18] [SPG] 30.0
[10:07:29] [SPG] 40.0
[10:08:37] [SPG] 50.0
[10:09:42] [SPG] 60.0
[10:10:45] [SPG] 70.0
[10:11:49] [SPG] 80.0
[10:12:52] [SPG] 90.0
[10:13:54] [SPG] 100.0
[10:13:54] [SPG] Writing current.xyz
[10:13:54] [SPG] Sequence 3 completed:
[10:13:54] SVEAKWPIQASTSSIYPAVAGKILVKLFPSLGPVIYVVDPQTGTNGAIFW . . .
[10:13:54] Iterations: 60 of 600
[10:13:55] Finished
[10:13:55] [SPG] seed: 23711216
[10:13:55] [SPG] Designing protein sequence 4 of 30
[10:15:24] [SPG] 10.0
[10:16:47] [SPG] 20.0
[10:18:06] [SPG] 30.0
[10:19:17] [SPG] 40.0
[10:20:23] [SPG] 50.0
[10:21:27] [SPG] 60.0
[10:22:30] [SPG] 70.0
[10:23:32] [SPG] 80.0
[10:24:34] [SPG] 90.0
[10:25:36] [SPG] 100.0
[10:25:36] [SPG] Writing current.xyz
[10:25:36] [SPG] Sequence 4 completed:
[10:25:36] QYVLQWPVNSSTSTMIGPPAGYYVIAZDTSVGPIMLIWIPTAGALGYAPV . . .
[10:25:36] Iterations: 80 of 600
[10:25:37] Finished
[10:25:38] [SPG] seed: 29639020
[10:25:38] [SPG] Designing protein sequence 5 of 30
[10:27:07] [SPG] 10.0
[10:28:32] [SPG] 20.0
[10:29:53] [SPG] 30.0
[10:31:09] [SPG] 40.0
[10:32:27] [SPG] 50.0